PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 432aa    MW: 49765.8 Da    PI: 8.468
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651482.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.44.5e-17175254789
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     ++ +  +g l lp +fa++h ++k++ + ++l+ ++gr+W v+++y+ +   + +++GW  F+++n+Lk+gD++vF l++ +e
  XP_016651482.1 175 QPVYIHRGYLHLPSEFARRH-LVKQRARNIILKILDGRTWVVEFKYETSI--TRFQRGWLAFARDNNLKVGDVCVFVLIDCNE 254
                     555667889***********.45567789***************555554..669**********************986333 PP

2B349.76.6e-163524311698
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     l +p +fa+++ +k  +++t+ l+  + rsW v+li   k ++  l +GW+eFv +n L egD+++F+l++r++  l+v++fr
  XP_016651482.1 352 LHVPVTFARSFVKK--RKQTVNLQV-RERSWPVNLIGHTKESGAKLCGGWREFVTENCLMEGDVCIFELIERNDIVLKVHIFR 431
                     789*****999755..445788665.88*******9877777788999**********************999999****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.2E-9979IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-9983IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-21162263IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-22163264IPR015300DNA-binding pseudobarrel domain
CDDcd100171.31E-20168263No hitNo description
PROSITE profilePS5086314.48169265IPR003340B3 DNA binding domain
SMARTSM010191.4E-13170263IPR003340B3 DNA binding domain
PfamPF023625.2E-15174255IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-20334431IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18334431IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.196337432IPR003340B3 DNA binding domain
CDDcd100178.88E-17339431No hitNo description
SMARTSM010192.0E-10341431IPR003340B3 DNA binding domain
PfamPF023625.5E-14352431IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MASLHDSPAS IPHFLRIILD KTSKKTRIKI PMKFLTRYGE NLSSPVHLKL PSGLEMEIEL  60
RRSNDGWVWF DKGWPEFSKL CSLDYEIEYP KPEMEETDSD SEEDDDDDDD DESGHARGEI  120
KRENDMPTKK DFGGSSSSRI FLGRMHPLTK SEKALALQRA NAFESEYPSF LVAIQPVYIH  180
RGYLHLPSEF ARRHLVKQRA RNIILKILDG RTWVVEFKYE TSITRFQRGW LAFARDNNLK  240
VGDVCVFVLI DCNERLFEVF FYRTNNAEDC PLSPGHGGVA IDRVEKRRNP MIKVETDCTT  300
NYENGKYKRL KTGGQVTQRP LNSSSRSLEA ANRFTPKNPS FRATLGSTPL ILHVPVTFAR  360
SFVKKRKQTV NLQVRERSWP VNLIGHTKES GAKLCGGWRE FVTENCLMEG DVCIFELIER  420
NDIVLKVHIF RC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_B1e-1814343122143B3 domain-containing transcription factor VRN
4i1k_A1e-1814343122143B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3249236e-45AF324923.1 Prunus armeniaca microsatellite ssrPaCITA13 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240722.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLM5WCL71e-109M5WCL7_PRUPE; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.12e-19related to vernalization1 1